Download - Las multiples caras de la bioinformatica
![Page 1: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/1.jpg)
![Page 2: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/2.jpg)
las multiples caras de la bioinformá[email protected]
![Page 3: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/3.jpg)
La bioinformática consiste en la creación y desarrollo de algoritmos, bases de datos, técnicas informáticas y estadísticas, y las bases teóricas para resolver problemas formales y prácticos en torno a la gestión y análisis de información biológica.
![Page 4: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/4.jpg)
La vida puede verse como un proceso de almacenamiento y transmisión de información biológica. La vida puede verse como un proceso de almacenamiento y transmisión de información biológica.
El ADN es la molécula portadora de esta información. El ADN es la molécula portadora de esta información.
Para entender la vida debemos identificar estas moléculas y descifrar el códigoPara entender la vida debemos identificar estas moléculas y descifrar el código
![Page 5: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/5.jpg)
![Page 6: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/6.jpg)
“We wish to propose a structure for the salt of desoxyribose nucleic acid (DNA). This structure has novel features which are of considerable biological interest”
“We wish to propose a structure for the salt of desoxyribose nucleic acid (DNA). This structure has novel features which are of considerable biological interest”
“It has not escaped our attention that the specific pairing we have postulated immediately suggests a possible copying mechanism for the genetic material.”
“It has not escaped our attention that the specific pairing we have postulated immediately suggests a possible copying mechanism for the genetic material.”
![Page 7: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/7.jpg)
Sanger determinó la secuencia de los aminoácidos de la insulina en 1955. Al hacerlo, demostró que las proteínas tienen estructuras específicas.
Sanger determinó la secuencia de los aminoácidos de la insulina en 1955. Al hacerlo, demostró que las proteínas tienen estructuras específicas.
Este resultado le valió su primer Premio Nobel de química en 1958Este resultado le valió su primer Premio Nobel de química en 1958
![Page 8: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/8.jpg)
Cuando Perutz llegó a Cambridge la estructura molecular más grande que se había resuelto era la del pigmento natural ficocianina, de 58 átomos.
Cuando Perutz llegó a Cambridge la estructura molecular más grande que se había resuelto era la del pigmento natural ficocianina, de 58 átomos.
El tema escogido por Perutz para su tesis fue otra proteína, la hemoglobina, el transportador de oxígeno que da color rojo a nuestra sangre. Tenía 11000 átomos.
El tema escogido por Perutz para su tesis fue otra proteína, la hemoglobina, el transportador de oxígeno que da color rojo a nuestra sangre. Tenía 11000 átomos.
![Page 9: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/9.jpg)
El primer Atlas of Protein Sequence and Structure, presentaba información sobre 65 proteinas. El primer Atlas of Protein Sequence and Structure, presentaba información sobre 65 proteinas.
![Page 10: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/10.jpg)
En 1971 se crea el Protein Data Bank. En 1974 tiene 12 estructuras
En 1971 se crea el Protein Data Bank. En 1974 tiene 12 estructuras
myoglobin hemoglobin
papain ribonuclease
lactate dehydrogenasecarboxypeptidase A
![Page 11: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/11.jpg)
Frederick Sanger publica en 1975 un método para la "Secuenciación del ADN mediante síntesis enzimática".Frederick Sanger publica en 1975 un método para la "Secuenciación del ADN mediante síntesis enzimática".
![Page 12: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/12.jpg)
El primer genoma de ADN completamente secuenciado fue el del bacteriófago φX174, en 1977El primer genoma de ADN completamente secuenciado fue el del bacteriófago φX174, en 1977
![Page 13: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/13.jpg)
5,386 bases
![Page 14: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/14.jpg)
11 genes
![Page 15: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/15.jpg)
In 1981 the EMBL Nucleotide Sequence Data Library is created. Version 2 was composed of 811 secuences, around 1 million bases introduced by hand.
In 1981 the EMBL Nucleotide Sequence Data Library is created. Version 2 was composed of 811 secuences, around 1 million bases introduced by hand.
![Page 16: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/16.jpg)
Smith TF, Waterman MS (1981). "Identification of common molecular subsequences.". J Mol Biol. 147 (1): 195-7.Smith TF, Waterman MS (1981). "Identification of common molecular subsequences.". J Mol Biol. 147 (1): 195-7.
![Page 17: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/17.jpg)
S.F. Altschul, et al. (1990), "Basic Local Alignment Search Tool," J. Molec. Biol., 215(3): 403-10, 1990. 15,306 citationsS.F. Altschul, et al. (1990), "Basic Local Alignment Search Tool," J. Molec. Biol., 215(3): 403-10, 1990. 15,306 citations
![Page 18: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/18.jpg)
J. Thompson, T. Gibson, D. Higgins (1994), CLUSTAL W: improving the sensitivity of progressive multiple sequence alignment. Nuc. Acids. Res. 22, 4673 - 4680
J. Thompson, T. Gibson, D. Higgins (1994), CLUSTAL W: improving the sensitivity of progressive multiple sequence alignment. Nuc. Acids. Res. 22, 4673 - 4680
![Page 19: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/19.jpg)
En 1995 se crea el European Bioinformatics instituteEn 1995 se crea el European Bioinformatics institute
![Page 20: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/20.jpg)
![Page 21: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/21.jpg)
![Page 22: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/22.jpg)
http://www.ensembl.org
![Page 23: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/23.jpg)
23
http://www.uniprot.org
![Page 24: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/24.jpg)
herramientas web
http://www.ebi.ac.uk/Tools/
![Page 25: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/25.jpg)
SOAP: Simple Object Access Protocol
fetchData(uniprot,wap_rat,default,xml)
servicios web
http://www.ebi.ac.uk/Tools/websevices
![Page 26: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/26.jpg)
http://taverna.sourceforge.net/
![Page 27: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/27.jpg)
http://www.myexperiment.org/users/471
![Page 28: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/28.jpg)
![Page 29: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/29.jpg)
http://www.ebi.ac.uk/dasty/
![Page 30: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/30.jpg)
15 de Febrero de 2001: se publica el borrador de la secuencia del genoma humano15 de Febrero de 2001: se publica el borrador de la secuencia del genoma humano
![Page 31: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/31.jpg)
![Page 32: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/32.jpg)
3,000,830,137 bases
![Page 33: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/33.jpg)
<2%
![Page 34: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/34.jpg)
![Page 35: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/35.jpg)
![Page 36: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/36.jpg)
![Page 37: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/37.jpg)
25,000 genes
![Page 38: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/38.jpg)
Bioinformatics: Gone in 2012
http://conferences.oreillynet.com/cs/bio2003/view/e_sess/3452
![Page 39: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/39.jpg)
98% ADN basura
![Page 40: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/40.jpg)
¿basura?
![Page 41: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/41.jpg)
ENCyclopedia Of DNA Elements
![Page 42: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/42.jpg)
Fire A, Xu S, Montgomery M, Kostas S, Driver S, Mello C (1998). "Potent and specific genetic interference by double-stranded RNA in Caenorhabditis elegans". Nature 391 (6669): 806–11. doi:10.1038/35888. PMID 9486653
![Page 43: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/43.jpg)
Hamilton A, Baulcombe D (1999). "A species of small antisense RNA in posttranscriptional gene silencing in plants". Science 286 (5441): 950–2. PMID 10542148
![Page 44: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/44.jpg)
Dr Alan Wolffe (1999)
• Epigenetics is heritable changes in gene expression that occur without a change in DNA sequence
• Such changes cannot be attributed to changes in DNA sequence (mutations)
• They are as Irreversible as mutations (or difficult to reverse)
![Page 45: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/45.jpg)
![Page 46: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/46.jpg)
99,99% idénticos
![Page 47: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/47.jpg)
VARIACIÓN EN LA SECUENCIA HUMANA DE DNA
Tasa de mutación = 10-8 /sitio/generación
Nº generaciones ancestro común-humano actual: 104-105
![Page 48: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/48.jpg)
10.000.000 SNPs
![Page 49: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/49.jpg)
![Page 50: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/50.jpg)
$10-million award for the first privately funded team
that can sequence 100 human genomes in 10 days
for less than 10.000$
![Page 51: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/51.jpg)
Applied Biosystems ABI 3730XL
Illumina / Solexa Genetic Analyzer
Applied BiosystemsSOLiD
Roche / 454 Genome Sequencer
1 Mb/day 100 Mb/run 3000 Mb/run
![Page 52: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/52.jpg)
Sequencing Fragment assembly problem The Shortest Superstring Problem Velvet (Zerbino, 2008) Sequencing Fragment assembly problem The Shortest Superstring Problem Velvet (Zerbino, 2008)
Gene finding Hidden Markov Models, pattern recognition methods GenScan (Burge & Karlin, 1997)Gene finding Hidden Markov Models, pattern recognition methods GenScan (Burge & Karlin, 1997)
Sequence comparison pairwise and multiple sequence alignments dynamic algorithm, heuristic methods PSI- BLAST (Altschul et. al., 1997) (SSAHA, 2001) (MUMmerGPU, 2008)
Sequence comparison pairwise and multiple sequence alignments dynamic algorithm, heuristic methods PSI- BLAST (Altschul et. al., 1997) (SSAHA, 2001) (MUMmerGPU, 2008)
![Page 53: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/53.jpg)
2560 JS21 blade computing nodes, each with 2 dual-core, 2.3 GHz, IBM 64-bit PowerPC 970MP processors 10240 CPUs | 20 TB of RAM | 280 TB of external disk
2560 JS21 blade computing nodes, each with 2 dual-core, 2.3 GHz, IBM 64-bit PowerPC 970MP processors 10240 CPUs | 20 TB of RAM | 280 TB of external disk
![Page 54: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/54.jpg)
![Page 55: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/55.jpg)
![Page 56: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/56.jpg)
Comparative genomics
Comparative genomics
Sequence (DNA/RNA) & phylogeny
Sequence (DNA/RNA) & phylogeny
Regulation of gene expression; transcription
factors & micro RNAs
Regulation of gene expression; transcription
factors & micro RNAs
Protein sequence analysis &evolution
Protein sequence analysis &evolution
Protein families, motifs and domains
Protein families, motifs and domains
Protein structure & function: computational crystallography
Protein structure & function: computational crystallography
Protein interactions & complexes: modelling and predictionProtein interactions & complexes: modelling and prediction
Chemical biologyChemical biology
Pathway analysisPathway analysis
Systems modelling
Systems modelling
Image analysisImage analysis
Data integration & literature miningData integration & literature mining
![Page 57: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/57.jpg)
AKJLSKDUCMMSLSIIEMMCSKLSKCSDCMSKLCCSDKCLSMCLKMCCLSKDCLSMCLSKCSCLSCLSMCLKSCDMCLMKMLWLKWLCMSKMCLSMCLSMCLSKCDJFIOIWELKMLXLWLWKMLWKCLWMCLWMCLWLWCLWKJCLWKCLKDWJCLWKDJCLK
![Page 58: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/58.jpg)
![Page 59: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/59.jpg)
![Page 60: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/60.jpg)
http://www.ebi.ac.uk/intact
![Page 61: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/61.jpg)
http://www.ebi.ac.uk/biomodels/
![Page 62: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/62.jpg)
http://www.cytoscape.org
![Page 63: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/63.jpg)
Bioinformatics: alive and kicking.
biologists are all bioinformaticians
now.
http://genomebiology.com/2008/9/12/114
![Page 64: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/64.jpg)
![Page 65: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/65.jpg)
una empresa de tecnología...
Análisis de datos, señales, imágenes
Análisis de datos, señales, imágenes
Modelado de sistemas, simulación
Modelado de sistemas, simulación
Bases de datos, data mining, IA
Bases de datos, data mining, IA
Tecnología, comunicación, computación
Tecnología, comunicación, computación
![Page 66: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/66.jpg)
con soluciones para el sector biomédico
gestión de datos
análisis estadístico
anotación análisis de redes
selección
30.000 genes
1500 genes
150 genes
50 elementos
10 targets
![Page 67: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/67.jpg)
queremos ser pieza fundamental
integrando procesos de I+D+i y tecnología en un mecanismo único que permita gestionar todo el proceso y donde la tecnología sea el eslabón más fuerte de la cadena
![Page 68: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/68.jpg)
datosgestiónanálisis
visualización
![Page 69: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/69.jpg)
data management
![Page 70: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/70.jpg)
https://carmaweb.genome.tugraz.at/
http://base.thep.lu.se/
![Page 71: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/71.jpg)
http://www.agml.org/
![Page 72: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/72.jpg)
http://www.openmicroscopy.org
![Page 73: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/73.jpg)
CONTENT: Minimal Information to be reported -> MIBBI (http://www.mibbi.org)
SEMANTIC: Terminology Used, Ontologies -> OBI (http://obi-ontology.org)
SYNTAX: Data Model, Data Exchange ->FUGE (http://fuge.sourceforge.net)
![Page 74: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/74.jpg)
data analysis
![Page 75: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/75.jpg)
Biological question
Testing
Biological verification and interpretation
experiment
Estimation
Experimental design
Image analysis
Normalization
Clustering Prediction
Expression quantification Pre-processing
Analysis
![Page 76: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/76.jpg)
Bioconductor for Expression Analysis
• Quickly becoming the accepted approach
• Open source
• Flexible
• (fairly) simple to use - intuitive
• Wide applications – many packages
http://www.bioconductor.org
![Page 77: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/77.jpg)
Trans-Proteomic Pipeline (TPP) is a collection of integrated tools for MS/MS proteomics
http://tools.proteomecenter.orghttp://proteowizard.sourceforge.nethttp://www.thegpm.org/TANDEM
![Page 78: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/78.jpg)
BIG data
![Page 79: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/79.jpg)
![Page 80: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/80.jpg)
![Page 81: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/81.jpg)
![Page 82: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/82.jpg)
![Page 83: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/83.jpg)
![Page 84: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/84.jpg)
![Page 85: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/85.jpg)
gestiónanálisis
visualización
literatura
![Page 86: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/86.jpg)
enriquecimiento semántico
extracción de información
![Page 87: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/87.jpg)
Antileukoproteinase, Secretory leukocyte protease inhibitor, P03973
uniprot: http://www.uniprot.org/uniprot/P03973genecards: http://www.genecards.org/cgi-bin/carddisp.pl?id=P03973dasty: http://www.ebi.ac.uk/dasty/client/ebi.php?q=P03973
>sp|P03973|SLPI_HUMAN Antileukoproteinase OS=Homo sapiens GN=SLPI MKSSGLFPFLVLLALGTLAPWAVEGSGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGK KRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMG MCGKSCVSPVKA
![Page 88: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/88.jpg)
![Page 89: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/89.jpg)
![Page 90: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/90.jpg)
![Page 91: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/91.jpg)
![Page 92: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/92.jpg)
retos de la biología en los próximos 50 años
• Listado de todos los componentes moleculares que forman un organismo:– Genes, proteinas, y otros elementos funcionales
• Comprender la funcion de cada componente• Comprender como interaccionan • Estudiar como la función ha evolucionado• Encontrar defectos geneticos que causan
enfermedades• Diseñar medicamentos y terapias de manera
racional• Secuenciar el genoma de cada individuo y usarlo en
una medicina personalizada
![Page 93: Las multiples caras de la bioinformatica](https://reader033.vdocumento.com/reader033/viewer/2022051323/547977bbb4af9f94348b4b65/html5/thumbnails/93.jpg)